Anti-SH3BP4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87902-50
Artikelname: Anti-SH3BP4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87902-50
Hersteller Artikelnummer: A87902-50
Alternativnummer: ABC-A87902-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SH3BP4.
Klonalität: Polyclonal
Molekulargewicht: 107 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRLIQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSYRDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDDFVI
Target-Kategorie: SH3BP4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000