Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A87903-100
Artikelname: |
Anti-NALP12 / NLRP12 Antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ABC-A87903-100 |
Hersteller Artikelnummer: |
A87903-100 |
Alternativnummer: |
ABC-A87903-100 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 862-1062 of human NLRP12 (NP_001264055.1). |
Konjugation: |
Unconjugated |
Rabbit polyclonal antibody to NALP12 / NLRP12. |
Klonalität: |
Polyclonal |
Molekulargewicht: |
120 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Formulierung: |
Liquid |
Sequenz: |
LWLKICRLTAAACDELASTLSVNQSLRELDLSLNELGDLGVLLLCEGLRHPTCKLQTLRLGICRLGSAACEGLSVVLQANHNLRELDLSFNDLGDWGLWLLAEGLQHPACRLQKLWLDSCGLTAKACENLYFTLGINQTLTDLYLTNNALGDTGVRLLCKRLSHPGCKLRVLWLFGMDLNKMTHSRLAALRVTKPYLDIGC |
Target-Kategorie: |
NALP12 / NLRP12 |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:500-1:2,000 |