Anti-MANEA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8791-50
Artikelname: Anti-MANEA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8791-50
Hersteller Artikelnummer: A8791-50
Alternativnummer: ABC-A8791-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human MANEA (NP_078917.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MANEA.
Klonalität: Polyclonal
Molekulargewicht: 54 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: RPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLN
Target-Kategorie: MANEA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000