Anti-ULK2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87924-100
Artikelname: Anti-ULK2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87924-100
Hersteller Artikelnummer: A87924-100
Alternativnummer: ABC-A87924-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ULK2 (NP_001136082.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ULK2.
Klonalität: Polyclonal
Molekulargewicht: 113 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAK
Target-Kategorie: ULK2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000