Anti-LAPTM4B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8793-100
Artikelname: Anti-LAPTM4B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8793-100
Hersteller Artikelnummer: A8793-100
Alternativnummer: ABC-A8793-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 218-317 of human LAPTM4B (NP_060877.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LAPTM4B.
Klonalität: Polyclonal
Molekulargewicht: 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: NSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA
Target-Kategorie: LAPTM4B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000