Anti-LLGL2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87936-100
Artikelname: Anti-LLGL2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87936-100
Hersteller Artikelnummer: A87936-100
Alternativnummer: ABC-A87936-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900-1000 of mouse LLGL2 (NP_663413.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LLGL2.
Klonalität: Polyclonal
Molekulargewicht: 114 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: IASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTL
Target-Kategorie: LLGL2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:100