Anti-TMC5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87947-50
Artikelname: Anti-TMC5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87947-50
Hersteller Artikelnummer: A87947-50
Alternativnummer: ABC-A87947-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TMC5.
Klonalität: Polyclonal
Molekulargewicht: 114 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA
Target-Kategorie: TMC5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000