Anti-FGFR1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87950-50
Artikelname: Anti-FGFR1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87950-50
Hersteller Artikelnummer: A87950-50
Alternativnummer: ABC-A87950-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FGFR1 (NP_075598.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FGFR1.
Klonalität: Polyclonal
Molekulargewicht: 100 - 120 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: IGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMK
Target-Kategorie: FGFR1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000