Anti-P cadherin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87960-50
Artikelname: Anti-P cadherin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87960-50
Hersteller Artikelnummer: A87960-50
Alternativnummer: ABC-A87960-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-350 of human CDH3 (NP_001784.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to P cadherin.
Klonalität: Polyclonal
Molekulargewicht: 115 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTG
Target-Kategorie: P cadherin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200