Anti-CHD1L Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87962-50
Artikelname: Anti-CHD1L Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87962-50
Hersteller Artikelnummer: A87962-50
Alternativnummer: ABC-A87962-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 320-570 of human CHD1L (NP_001243267.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CHD1L.
Klonalität: Polyclonal
Molekulargewicht: 101 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KLLASEGSTMDEIDLESILGETKDGQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKD
Target-Kategorie: CHD1L
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000