Anti-Meckelin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87968-50
Artikelname: Anti-Meckelin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87968-50
Hersteller Artikelnummer: A87968-50
Alternativnummer: ABC-A87968-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 780-940 of human TMEM67 (NP_714915.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Meckelin.
Klonalität: Polyclonal
Molekulargewicht: 115 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKLLLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLL
Target-Kategorie: Meckelin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000