Anti-STK31 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87969-100
Artikelname: Anti-STK31 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87969-100
Hersteller Artikelnummer: A87969-100
Alternativnummer: ABC-A87969-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 890-1019 of human STK31 (NP_113602.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to STK31.
Klonalität: Polyclonal
Molekulargewicht: 115 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GDLSLMSPELKMGKPASPGSDLYAYGCLLLWLSVQNQEFEINKDGIPKVDQFHLDDKVKSLLCSLICYRSSMTAEQVLNAECFLMPKEQSVPNPEKDTEYTLYKKEEEIKTENLDKCMEKTRNGEANFDC
Target-Kategorie: STK31
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000