Anti-COL1A2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A87990-50
Artikelname: Anti-COL1A2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A87990-50
Hersteller Artikelnummer: A87990-50
Alternativnummer: ABC-A87990-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to COL1A2.
Klonalität: Polyclonal
Molekulargewicht: 140 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA
Target-Kategorie: COL1A2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200