Anti-PTN Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88436-50
Artikelname: Anti-PTN Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88436-50
Hersteller Artikelnummer: A88436-50
Alternativnummer: ABC-A88436-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PTN (NP_002816.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PTN.
Klonalität: Polyclonal
Molekulargewicht: 19 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Target-Kategorie: PTN
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000