Anti-CENPA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88437-100
Artikelname: Anti-CENPA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88437-100
Hersteller Artikelnummer: A88437-100
Alternativnummer: ABC-A88437-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA (NP_001800.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CENPA.
Klonalität: Polyclonal
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Target-Kategorie: CENPA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, ICC/IF: 1:50-1:100