Anti-FXYD1 / PLM Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88447-50
Artikelname: Anti-FXYD1 / PLM Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88447-50
Hersteller Artikelnummer: A88447-50
Alternativnummer: ABC-A88447-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-92 of human FXYD1 (NP_005022.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FXYD1 / PLM.
Klonalität: Polyclonal
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Target-Kategorie: FXYD1 / PLM
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000