Anti-TCEB2 / Elongin-B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88455-100
Artikelname: Anti-TCEB2 / Elongin-B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88455-100
Hersteller Artikelnummer: A88455-100
Alternativnummer: ABC-A88455-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human TCEB2 (NP_009039.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TCEB2 / Elongin-B.
Klonalität: Polyclonal
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Target-Kategorie: TCEB2 / Elongin-B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, IP: 1:20-1:50