Anti-Gemin6 / SIP2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88465-100
Artikelname: Anti-Gemin6 / SIP2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88465-100
Hersteller Artikelnummer: A88465-100
Alternativnummer: ABC-A88465-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human GEMIN6 (NP_079051.9).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Gemin6 / SIP2.
Klonalität: Polyclonal
Molekulargewicht: 19 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ
Target-Kategorie: Gemin6 / SIP2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000