Anti-alpha Lactalbumin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88470-100
Artikelname: Anti-alpha Lactalbumin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88470-100
Hersteller Artikelnummer: A88470-100
Alternativnummer: ABC-A88470-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-142 of human LALBA (NP_002280.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to alpha Lactalbumin.
Klonalität: Polyclonal
Molekulargewicht: 14 - 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL
Target-Kategorie: alpha Lactalbumin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000