Anti-Plexin-B3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88497-100
Artikelname: Anti-Plexin-B3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88497-100
Hersteller Artikelnummer: A88497-100
Alternativnummer: ABC-A88497-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1250 of human PLXNB3 (NP_001156729.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Plexin-B3.
Klonalität: Polyclonal
Molekulargewicht: 172 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: RGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVV
Target-Kategorie: Plexin-B3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000