Anti-NFAT5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88501-50
Artikelname: Anti-NFAT5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88501-50
Hersteller Artikelnummer: A88501-50
Alternativnummer: ABC-A88501-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NFAT5.
Klonalität: Polyclonal
Molekulargewicht: 174 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Target-Kategorie: NFAT5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000