Anti-ALK Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88507-100
Artikelname: Anti-ALK Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88507-100
Hersteller Artikelnummer: A88507-100
Alternativnummer: ABC-A88507-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1550-1620 of human ALK (NP_004295.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ALK.
Klonalität: Polyclonal
Molekulargewicht: 86 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Target-Kategorie: ALK
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:100