Anti-4E-T Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88511-50
Artikelname: Anti-4E-T Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88511-50
Hersteller Artikelnummer: A88511-50
Alternativnummer: ABC-A88511-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EIF4ENIF1 (NP_001157973.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to 4E-T.
Klonalität: Polyclonal
Molekulargewicht: 178 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LGGRRIGSGRIISARTFEKDHRLSDKDLRDLRDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGR
Target-Kategorie: 4E-T
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200