Anti-FGD5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88512-50
Artikelname: Anti-FGD5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88512-50
Hersteller Artikelnummer: A88512-50
Alternativnummer: ABC-A88512-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1000-1200 of human FGD5 (NP_689749.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FGD5.
Klonalität: Polyclonal
Molekulargewicht: 178 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: YLGLLSENCLHSPRLAAAVREFEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVLLYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
Target-Kategorie: FGD5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000