Anti-Calmodulin 1 / 2 / 3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88516-100
Artikelname: Anti-Calmodulin 1 / 2 / 3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88516-100
Hersteller Artikelnummer: A88516-100
Alternativnummer: ABC-A88516-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-149 of human CALM3 (NP_005175.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Calmodulin 1 / 2 / 3.
Klonalität: Polyclonal
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target-Kategorie: Calmodulin 1 / 2 / 3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200