Anti-CYB5B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88713-50
Artikelname: Anti-CYB5B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88713-50
Hersteller Artikelnummer: A88713-50
Alternativnummer: ABC-A88713-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CYB5B.
Klonalität: Polyclonal
Molekulargewicht: 20 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Target-Kategorie: CYB5B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000