Anti-Gamma B crystallin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88721-100
Artikelname: Anti-Gamma B crystallin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88721-100
Hersteller Artikelnummer: A88721-100
Alternativnummer: ABC-A88721-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-135 of human CRYGB (NP_005201.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Gamma B crystallin.
Klonalität: Polyclonal
Molekulargewicht: 21 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: CLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILY
Target-Kategorie: Gamma B crystallin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000