Anti-Proteasome Activator Subunit 4 / PSME4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88730-100
Artikelname: Anti-Proteasome Activator Subunit 4 / PSME4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88730-100
Hersteller Artikelnummer: A88730-100
Alternativnummer: ABC-A88730-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1634-1843 of human PSME4 (NP_055429.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Proteasome Activator Subunit 4 / PSME4.
Klonalität: Polyclonal
Molekulargewicht: 211 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
Target-Kategorie: Proteasome Activator Subunit 4 / PSME4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200