Anti-SSR3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88755-50
Artikelname: Anti-SSR3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88755-50
Hersteller Artikelnummer: A88755-50
Alternativnummer: ABC-A88755-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human SSR3 (NP_009038.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SSR3.
Klonalität: Polyclonal
Molekulargewicht: 21 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLF
Target-Kategorie: SSR3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200