Anti-Myosin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88758-50
Artikelname: Anti-Myosin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88758-50
Hersteller Artikelnummer: A88758-50
Alternativnummer: ABC-A88758-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1450-1550 of human MYH4 (NP_060003.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Myosin.
Klonalität: Polyclonal
Molekulargewicht: 250 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: QRNFDKVLAEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDHLETLKRENKNLQQEISDLTEQIAEGGKHIHELEKVKKQLDHEKSELQTSLEE
Target-Kategorie: Myosin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200