Anti-MYH2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88759-100
Artikelname: Anti-MYH2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88759-100
Hersteller Artikelnummer: A88759-100
Alternativnummer: ABC-A88759-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human MYH2 (NP_001093582.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MYH2.
Klonalität: Polyclonal
Molekulargewicht: 250 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SFKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSF
Target-Kategorie: MYH2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200