Anti-Claudin 4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88764-50
Artikelname: Anti-Claudin 4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88764-50
Hersteller Artikelnummer: A88764-50
Alternativnummer: ABC-A88764-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CLDN4 (NP_001296.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Claudin 4.
Klonalität: Polyclonal
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Target-Kategorie: Claudin 4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:100