Anti-IGF1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88771-100
Artikelname: Anti-IGF1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88771-100
Hersteller Artikelnummer: A88771-100
Alternativnummer: ABC-A88771-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to IGF1.
Klonalität: Polyclonal
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN
Target-Kategorie: IGF1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:100