Anti-SPC24 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88773-50
Artikelname: Anti-SPC24 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88773-50
Hersteller Artikelnummer: A88773-50
Alternativnummer: ABC-A88773-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human SPC24 (NP_872319.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SPC24.
Klonalität: Polyclonal
Molekulargewicht: 26 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW
Target-Kategorie: SPC24
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000