Anti-NKIRAS1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88783-100
Artikelname: Anti-NKIRAS1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88783-100
Hersteller Artikelnummer: A88783-100
Alternativnummer: ABC-A88783-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 118-192 of human NKIRAS1 (NP_065078.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NKIRAS1.
Klonalität: Polyclonal
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN
Target-Kategorie: NKIRAS1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200