Anti-DNAL1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88802-100
Artikelname: Anti-DNAL1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88802-100
Hersteller Artikelnummer: A88802-100
Alternativnummer: ABC-A88802-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-190 of human DNAL1 (NP_113615.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DNAL1.
Klonalität: Polyclonal
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: DASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Target-Kategorie: DNAL1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200