Anti-Separase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88806-50
Artikelname: Anti-Separase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88806-50
Hersteller Artikelnummer: A88806-50
Alternativnummer: ABC-A88806-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1220-1500 of human ESPL1 (NP_036423.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Separase.
Klonalität: Polyclonal
Molekulargewicht: 233 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: DEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPHLEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGRQKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQAPRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVVAPGSAPGNPGLNGRSRRAKKVASRHCEERRPQR
Target-Kategorie: Separase
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000, ICC/IF: 1:50-1:200