Anti-HBEGF / DTR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88815-50
Artikelname: Anti-HBEGF / DTR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88815-50
Hersteller Artikelnummer: A88815-50
Alternativnummer: ABC-A88815-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human HB-EGF (NP_001936.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to HBEGF / DTR.
Klonalität: Polyclonal
Molekulargewicht: 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Target-Kategorie: HBEGF / DTR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200