Anti-ZCCHC17 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89005-100
Artikelname: Anti-ZCCHC17 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89005-100
Hersteller Artikelnummer: A89005-100
Alternativnummer: ABC-A89005-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human ZCCHC17 (NP_057589.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZCCHC17.
Klonalität: Polyclonal
Molekulargewicht: 27 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE
Target-Kategorie: ZCCHC17
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000