Anti-PGP9.5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89018-50
Artikelname: Anti-PGP9.5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89018-50
Hersteller Artikelnummer: A89018-50
Alternativnummer: ABC-A89018-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PGP9.5.
Klonalität: Polyclonal
Molekulargewicht: 25 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
Target-Kategorie: PGP9.5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000