Anti-HLA Class 1 ABC Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8902-100
Artikelname: Anti-HLA Class 1 ABC Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8902-100
Hersteller Artikelnummer: A8902-100
Alternativnummer: ABC-A8902-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-B (NP_005505.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to HLA Class 1 ABC.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
Target-Kategorie: HLA Class 1 ABC
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200