Anti-DDIT3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89024-100
Artikelname: Anti-DDIT3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89024-100
Hersteller Artikelnummer: A89024-100
Alternativnummer: ABC-A89024-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human DDIT3/CHOP (NP_004074.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DDIT3.
Klonalität: Polyclonal
Molekulargewicht: 27 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSP
Target-Kategorie: DDIT3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200, IHC: 1:50-1:200