Anti-FADD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89025-50
Artikelname: Anti-FADD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89025-50
Hersteller Artikelnummer: A89025-50
Alternativnummer: ABC-A89025-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human FADD (Q13158).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FADD.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Target-Kategorie: FADD
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500