Anti-Stanniocalcin 1 / STC Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89026-100
Artikelname: Anti-Stanniocalcin 1 / STC Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89026-100
Hersteller Artikelnummer: A89026-100
Alternativnummer: ABC-A89026-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-247 of human STC1 (NP_003146.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Stanniocalcin 1 / STC.
Klonalität: Polyclonal
Molekulargewicht: 27 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Target-Kategorie: Stanniocalcin 1 / STC
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000