Anti-CSMD2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89028-50
Artikelname: Anti-CSMD2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89028-50
Hersteller Artikelnummer: A89028-50
Alternativnummer: ABC-A89028-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CSMD2.
Klonalität: Polyclonal
Molekulargewicht: 280 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECL
Target-Kategorie: CSMD2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000