Anti-NOTCH3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89029-50
Artikelname: Anti-NOTCH3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89029-50
Hersteller Artikelnummer: A89029-50
Alternativnummer: ABC-A89029-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2200 to the C-terminus of human NOTCH3 (NP_000426.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NOTCH3.
Klonalität: Polyclonal
Molekulargewicht: 90 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: TPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Target-Kategorie: NOTCH3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:50-1:200