Anti-KAT3B / p300 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89032-50
Artikelname: Anti-KAT3B / p300 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89032-50
Hersteller Artikelnummer: A89032-50
Alternativnummer: ABC-A89032-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EP300 (NP_001420.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to KAT3B / p300.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYG
Target-Kategorie: KAT3B / p300
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:200, ICC/IF: 1:50-1:200