Anti-Tet2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89035-50
Artikelname: Anti-Tet2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89035-50
Hersteller Artikelnummer: A89035-50
Alternativnummer: ABC-A89035-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of TET2 (NP_001120680.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Tet2.
Klonalität: Polyclonal
Molekulargewicht: 280 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSYYGIPCMKGSQNSRVSPDFTQESRGYSKCLQNGGIKRTVSEPSLSGLLQIKKLKQDQKANGERRNFGVSQERNPGESSQPNVSDLSDKKESVSSVAQENAVKDFTSFSTHNCSGPENPELQILNEQEGKSANYHDKNIVLLKNKAVLMPNGATVSASSVEHTHGELLEKTLSQYYPDCVSIAVQKTTSHINAINS
Target-Kategorie: Tet2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500