Anti-BRWD1 / WDR9 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89036-100
Artikelname: Anti-BRWD1 / WDR9 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89036-100
Hersteller Artikelnummer: A89036-100
Alternativnummer: ABC-A89036-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to BRWD1 / WDR9.
Klonalität: Polyclonal
Molekulargewicht: 263 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
Target-Kategorie: BRWD1 / WDR9
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:3,000