Anti-14-3-3 zeta Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89039-100
Artikelname: Anti-14-3-3 zeta Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89039-100
Hersteller Artikelnummer: A89039-100
Alternativnummer: ABC-A89039-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human YWHAZ (NP_001129171.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to 14-3-3 zeta.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Target-Kategorie: 14-3-3 zeta
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000